PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000807087
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NAC
Protein Properties Length: 62aa    MW: 7123.31 Da    PI: 4.8023
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000807087genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM51.43.6e-161460148
            NAM  1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp 48
                   lppGfrF+Ptdeelv +yL+ kv + +l++ ++i+e++++ ++PwdLp
  MDP0000807087 14 LPPGFRFQPTDEELVFQYLRCKVFSCPLPA-SIIPEINVCLYDPWDLP 60
                   79****************************.89**************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.71E-19961IPR003441NAC domain
PROSITE profilePS5100520.1911461IPR003441NAC domain
PfamPF023654.2E-71539IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 62 aa     Download sequence    Send to blast
MDKFNFLRNG MSRLPPGFRF QPTDEELVFQ YLRCKVFSCP LPASIIPEIN VCLYDPWDLP  60
G*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008392723.19e-43PREDICTED: NAC transcription factor 29-like
SwissprotQ9FY932e-25NAC83_ARATH; NAC domain-containing protein 83
TrEMBLM5WSR91e-40M5WSR9_PRUPE; Uncharacterized protein
STRINGGLYMA05G38380.11e-35(Glycine max)
STRINGGLYMA08G01280.11e-35(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF70434139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13180.19e-27NAC domain containing protein 83